GHR Peptide - C-terminal region

Produktübersicht

• Artikelname: GHR Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004135
• Hersteller Artikelnummer: orb2004135
• Alternativnummer: BYT-ORB2004135-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: GHBP

Produktbeschreibung

GHR Peptide - C-terminal region

Produkteigenschaften

• NCBI: 001229391
• UniProt: P10912
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: YSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFYFPW

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with GHR Rabbit Polyclonal Antibody (orb579099). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings