GHR Peptide - C-terminal region

Product Overview

• Article Name: GHR Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004135
• Supplier Catalog Number: orb2004135
• Alternative Catalog Number: BYT-ORB2004135-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: GHBP

Product Description

GHR Peptide - C-terminal region

Product Properties

• NCBI: 001229391
• UniProt: P10912
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: YSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFYFPW

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with GHR Rabbit Polyclonal Antibody (orb579099). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings