MARCH2 Peptide - C-terminal region

Artikelnummer: BYT-ORB2004137
Artikelname: MARCH2 Peptide - C-terminal region
Artikelnummer: BYT-ORB2004137
Hersteller Artikelnummer: orb2004137
Alternativnummer: BYT-ORB2004137-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: MARCH-II, RNF172
MARCH2 Peptide - C-terminal region
NCBI: 057580
UniProt: Q9P0N8
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: IALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPL
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with MARCH2 Rabbit Polyclonal Antibody (orb55671). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings