MARCH2 Peptide - C-terminal region

Product Overview

• Article Name: MARCH2 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004137
• Supplier Catalog Number: orb2004137
• Alternative Catalog Number: BYT-ORB2004137-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: MARCH-II, RNF172

Product Description

MARCH2 Peptide - C-terminal region

Product Properties

• NCBI: 057580
• UniProt: Q9P0N8
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: IALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with MARCH2 Rabbit Polyclonal Antibody (orb55671). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings