KIR3DS1 Peptide - middle region

Artikelnummer: BYT-ORB2004138
Artikelname: KIR3DS1 Peptide - middle region
Artikelnummer: BYT-ORB2004138
Hersteller Artikelnummer: orb2004138
Alternativnummer: BYT-ORB2004138-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
KIR3DS1 Peptide - middle region
UniProt: Q4KN23
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: IMFEHFFLHKEWISKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYG
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with KIR3DS1 Rabbit Polyclonal Antibody (orb578454). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings