KIR3DS1 Peptide - middle region

Product Overview

• Article Name: KIR3DS1 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004138
• Supplier Catalog Number: orb2004138
• Alternative Catalog Number: BYT-ORB2004138-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

KIR3DS1 Peptide - middle region

Product Properties

• UniProt: Q4KN23
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: IMFEHFFLHKEWISKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYG

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with KIR3DS1 Rabbit Polyclonal Antibody (orb578454). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings