DESI2 Peptide - C-terminal region

Produktübersicht

• Artikelname: DESI2 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004139
• Hersteller Artikelnummer: orb2004139
• Alternativnummer: BYT-ORB2004139-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: C1orf121, DESI, DESI1, DeSI-2, FAM152A, PNAS-4, PPPDE1

Produktbeschreibung

DESI2 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 057160
• UniProt: Q9BSY9
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: SCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHT

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with DESI2 Rabbit Polyclonal Antibody (orb324957). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings