DESI2 Peptide - C-terminal region

Product Overview

• Article Name: DESI2 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004139
• Supplier Catalog Number: orb2004139
• Alternative Catalog Number: BYT-ORB2004139-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: C1orf121, DESI, DESI1, DeSI-2, FAM152A, PNAS-4, PPPDE1

Product Description

DESI2 Peptide - C-terminal region

Product Properties

• NCBI: 057160
• UniProt: Q9BSY9
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: SCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHT

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with DESI2 Rabbit Polyclonal Antibody (orb324957). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings