ZNF202 Peptide - N-terminal region

Artikelnummer: BYT-ORB2004142
Artikelname: ZNF202 Peptide - N-terminal region
Artikelnummer: BYT-ORB2004142
Hersteller Artikelnummer: orb2004142
Alternativnummer: BYT-ORB2004142-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: ZSCAN42, ZKSCAN10
ZNF202 Peptide - N-terminal region
NCBI: 001288708
UniProt: O95125
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: MATALEPEDQDLWEEEGVLMVKLEDDFTCGPESALEGDDPVLETSHQNFR
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with ZNF202 Rabbit Polyclonal Antibody (orb324758). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings