ZNF202 Peptide - N-terminal region

Product Overview

• Article Name: ZNF202 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004142
• Supplier Catalog Number: orb2004142
• Alternative Catalog Number: BYT-ORB2004142-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: ZSCAN42, ZKSCAN10

Product Description

ZNF202 Peptide - N-terminal region

Product Properties

• NCBI: 001288708
• UniProt: O95125
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: MATALEPEDQDLWEEEGVLMVKLEDDFTCGPESALEGDDPVLETSHQNFR

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ZNF202 Rabbit Polyclonal Antibody (orb324758). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings