Mkx Peptide - C-terminal region

Produktübersicht

• Artikelname: Mkx Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004144
• Hersteller Artikelnummer: orb2004144
• Alternativnummer: BYT-ORB2004144-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: 9430023B20Rik, Irxl1

Produktbeschreibung

Mkx Peptide - C-terminal region

Produkteigenschaften

• NCBI: 808263
• UniProt: Q8BIA3
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: SNEFEEELVSPSSSETEGTFVYRTDTPDIGSTKGDSAANRRGPSKDDTYW

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with Mkx Rabbit Polyclonal Antibody (orb576342). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings