Mkx Peptide - C-terminal region

Product Overview

• Article Name: Mkx Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004144
• Supplier Catalog Number: orb2004144
• Alternative Catalog Number: BYT-ORB2004144-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: 9430023B20Rik, Irxl1

Product Description

Mkx Peptide - C-terminal region

Product Properties

• NCBI: 808263
• UniProt: Q8BIA3
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: SNEFEEELVSPSSSETEGTFVYRTDTPDIGSTKGDSAANRRGPSKDDTYW

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Mkx Rabbit Polyclonal Antibody (orb576342). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings