Esr2 Peptide - N-terminal region

Produktübersicht

• Artikelname: Esr2 Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004145
• Hersteller Artikelnummer: orb2004145
• Alternativnummer: BYT-ORB2004145-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: ER[b], ERbeta, Estrb

Produktbeschreibung

Esr2 Peptide - N-terminal region

Produkteigenschaften

• NCBI: 997590
• UniProt: O08537
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: SQSILPLEHGPIYIPSSYVESRHEYSAMTFYSPAVMNYSVPSSTGNLEGG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with Esr2 Rabbit Polyclonal Antibody (orb576189). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings