Esr2 Peptide - N-terminal region

Product Overview

• Article Name: Esr2 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004145
• Supplier Catalog Number: orb2004145
• Alternative Catalog Number: BYT-ORB2004145-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: ER[b], ERbeta, Estrb

Product Description

Esr2 Peptide - N-terminal region

Product Properties

• NCBI: 997590
• UniProt: O08537
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: SQSILPLEHGPIYIPSSYVESRHEYSAMTFYSPAVMNYSVPSSTGNLEGG

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with Esr2 Rabbit Polyclonal Antibody (orb576189). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings