SNAPC2 Peptide - C-terminal region

Artikelnummer: BYT-ORB2004146
Artikelname: SNAPC2 Peptide - C-terminal region
Artikelnummer: BYT-ORB2004146
Hersteller Artikelnummer: orb2004146
Alternativnummer: BYT-ORB2004146-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: PTFDELTA, SNAP45
SNAPC2 Peptide - C-terminal region
NCBI: 003074
UniProt: Q13487
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: EEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPLLP
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with SNAPC2 Rabbit Polyclonal Antibody (orb576099). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings