SNAPC2 Peptide - C-terminal region

Catalog Number: BYT-ORB2004146
Article Name: SNAPC2 Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2004146
Supplier Catalog Number: orb2004146
Alternative Catalog Number: BYT-ORB2004146-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: PTFDELTA, SNAP45
SNAPC2 Peptide - C-terminal region
NCBI: 003074
UniProt: Q13487
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: EEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPLLP
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with SNAPC2 Rabbit Polyclonal Antibody (orb576099). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings