JADE1 Peptide - C-terminal region

Artikelnummer: BYT-ORB2004147
Artikelname: JADE1 Peptide - C-terminal region
Artikelnummer: BYT-ORB2004147
Hersteller Artikelnummer: orb2004147
Alternativnummer: BYT-ORB2004147-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: PHF17
JADE1 Peptide - C-terminal region
NCBI: 001274366
UniProt: Q6IE81
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: DLAEALVDFIYQYWKLKRKANANQPLLTPKTDEVDNLAQQEQDVLYRRLK
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with JADE1 Rabbit Polyclonal Antibody (orb324576). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings