JADE1 Peptide - C-terminal region

Catalog Number: BYT-ORB2004147
Article Name: JADE1 Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2004147
Supplier Catalog Number: orb2004147
Alternative Catalog Number: BYT-ORB2004147-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
Alternative Names: PHF17
JADE1 Peptide - C-terminal region
NCBI: 001274366
UniProt: Q6IE81
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: DLAEALVDFIYQYWKLKRKANANQPLLTPKTDEVDNLAQQEQDVLYRRLK
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with JADE1 Rabbit Polyclonal Antibody (orb324576). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings