ZSCAN22 Peptide - N-terminal region

Produktübersicht

• Artikelname: ZSCAN22 Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004148
• Hersteller Artikelnummer: orb2004148
• Alternativnummer: BYT-ORB2004148-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: HKR2, ZNF50

Produktbeschreibung

ZSCAN22 Peptide - N-terminal region

Produkteigenschaften

• NCBI: 862829
• UniProt: P10073
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: RFRHFRYEEASGPHEALAHLRALCCQWLQPEAHSKEQILELLVLEQFLGA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with ZSCAN22 Rabbit Polyclonal Antibody (orb574710). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings