ZSCAN22 Peptide - N-terminal region

Product Overview

• Article Name: ZSCAN22 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004148
• Supplier Catalog Number: orb2004148
• Alternative Catalog Number: BYT-ORB2004148-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: HKR2, ZNF50

Product Description

ZSCAN22 Peptide - N-terminal region

Product Properties

• NCBI: 862829
• UniProt: P10073
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: RFRHFRYEEASGPHEALAHLRALCCQWLQPEAHSKEQILELLVLEQFLGA

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ZSCAN22 Rabbit Polyclonal Antibody (orb574710). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings