ZNF589 Peptide - C-terminal region

Artikelnummer: BYT-ORB2004151
Artikelname: ZNF589 Peptide - C-terminal region
Artikelnummer: BYT-ORB2004151
Hersteller Artikelnummer: orb2004151
Alternativnummer: BYT-ORB2004151-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: SZF1
ZNF589 Peptide - C-terminal region
NCBI: 057173
UniProt: Q86UQ0
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: SCKPYLIRHQRTHTREKSFMCTVCGRGFREKSELIKHQRIHTGDKPYVCR
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with ZNF589 Rabbit Polyclonal Antibody (orb574320). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings