ZNF589 Peptide - C-terminal region

Product Overview

• Article Name: ZNF589 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004151
• Supplier Catalog Number: orb2004151
• Alternative Catalog Number: BYT-ORB2004151-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: SZF1

Product Description

ZNF589 Peptide - C-terminal region

Product Properties

• NCBI: 057173
• UniProt: Q86UQ0
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: SCKPYLIRHQRTHTREKSFMCTVCGRGFREKSELIKHQRIHTGDKPYVCR

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ZNF589 Rabbit Polyclonal Antibody (orb574320). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings