KLF3 Peptide - C-terminal region

Produktübersicht

• Artikelname: KLF3 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004154
• Hersteller Artikelnummer: orb2004154
• Alternativnummer: BYT-ORB2004154-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: BKLF

Produktbeschreibung

KLF3 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 057615
• UniProt: P57682
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: SHLQQPLMVSLSEEMENSSSSMQVPVIESYEKPISQKKIKIEPGIEPQRT

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with KLF3 Rabbit Polyclonal Antibody (orb574080). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings