KLF3 Peptide - C-terminal region

Product Overview

• Article Name: KLF3 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004154
• Supplier Catalog Number: orb2004154
• Alternative Catalog Number: BYT-ORB2004154-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: BKLF

Product Description

KLF3 Peptide - C-terminal region

Product Properties

• NCBI: 057615
• UniProt: P57682
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: SHLQQPLMVSLSEEMENSSSSMQVPVIESYEKPISQKKIKIEPGIEPQRT

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with KLF3 Rabbit Polyclonal Antibody (orb574080). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings