CCR2 Peptide - N-terminal region

Produktübersicht

• Artikelname: CCR2 Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004158
• Hersteller Artikelnummer: orb2004158
• Alternativnummer: BYT-ORB2004158-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: CC-CKR-2, CCR-2, CCR2A, CCR2B, CD192, CKR2, CKR2A, CKR2B, CMKBR2, MCP-1-R

Produktbeschreibung

CCR2 Peptide - N-terminal region

Produkteigenschaften

• NCBI: 001116868
• UniProt: P41597
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: RSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with CCR2 Rabbit Polyclonal Antibody (orb573688). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings