CCR2 Peptide - N-terminal region

Product Overview

• Article Name: CCR2 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004158
• Supplier Catalog Number: orb2004158
• Alternative Catalog Number: BYT-ORB2004158-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: CC-CKR-2, CCR-2, CCR2A, CCR2B, CD192, CKR2, CKR2A, CKR2B, CMKBR2, MCP-1-R

Product Description

CCR2 Peptide - N-terminal region

Product Properties

• NCBI: 001116868
• UniProt: P41597
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: RSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIF

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with CCR2 Rabbit Polyclonal Antibody (orb573688). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings