RIOX2 Peptide - C-terminal region

Produktübersicht

• Artikelname: RIOX2 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004160
• Hersteller Artikelnummer: orb2004160
• Alternativnummer: BYT-ORB2004160-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: ROX, MDIG, MINA, NO52, JMJD10, MINA53

Produktbeschreibung

RIOX2 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 694822
• UniProt: Q8IUF8
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: LTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFPLSH

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with RIOX2 Rabbit Polyclonal Antibody (orb573553). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings