RIOX2 Peptide - C-terminal region

Product Overview

• Article Name: RIOX2 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004160
• Supplier Catalog Number: orb2004160
• Alternative Catalog Number: BYT-ORB2004160-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: ROX, MDIG, MINA, NO52, JMJD10, MINA53

Product Description

RIOX2 Peptide - C-terminal region

Product Properties

• NCBI: 694822
• UniProt: Q8IUF8
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFPLSH

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with RIOX2 Rabbit Polyclonal Antibody (orb573553). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings