SLC38A8 Peptide - C-terminal region

Artikelnummer: BYT-ORB2004161
Artikelname: SLC38A8 Peptide - C-terminal region
Artikelnummer: BYT-ORB2004161
Hersteller Artikelnummer: orb2004161
Alternativnummer: BYT-ORB2004161-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
SLC38A8 Peptide - C-terminal region
NCBI: 001073911
UniProt: A6NNN8
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: VSVLSLLACCLIYSLTGVYGFLTFGTEVSADVLMSYPGNDMVIIVARVLF
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with SLC38A8 Rabbit Polyclonal Antibody (orb587749). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings