SLC38A8 Peptide - C-terminal region

Product Overview

• Article Name: SLC38A8 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004161
• Supplier Catalog Number: orb2004161
• Alternative Catalog Number: BYT-ORB2004161-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

SLC38A8 Peptide - C-terminal region

Product Properties

• NCBI: 001073911
• UniProt: A6NNN8
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: VSVLSLLACCLIYSLTGVYGFLTFGTEVSADVLMSYPGNDMVIIVARVLF

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with SLC38A8 Rabbit Polyclonal Antibody (orb587749). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings