SERGEF Peptide - C-terminal region

Artikelnummer: BYT-ORB2004162
Artikelname: SERGEF Peptide - C-terminal region
Artikelnummer: BYT-ORB2004162
Hersteller Artikelnummer: orb2004162
Alternativnummer: BYT-ORB2004162-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: DELGEF, Gnefr
SERGEF Peptide - C-terminal region
NCBI: 036271
UniProt: Q9UGK8
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: HPALVQDPKVTYLSPDAIEDTESQKAMDKERNWKERQSETSTQSQSDWSR
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with SERGEF Rabbit Polyclonal Antibody (orb587745). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings