SERGEF Peptide - C-terminal region

Product Overview

• Article Name: SERGEF Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004162
• Supplier Catalog Number: orb2004162
• Alternative Catalog Number: BYT-ORB2004162-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: DELGEF, Gnefr

Product Description

SERGEF Peptide - C-terminal region

Product Properties

• NCBI: 036271
• UniProt: Q9UGK8
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: HPALVQDPKVTYLSPDAIEDTESQKAMDKERNWKERQSETSTQSQSDWSR

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with SERGEF Rabbit Polyclonal Antibody (orb587745). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings