PRSS55 Peptide - C-terminal region

Produktübersicht

• Artikelname: PRSS55 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004166
• Hersteller Artikelnummer: orb2004166
• Alternativnummer: BYT-ORB2004166-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: T-SP1, UNQ9391

Produktbeschreibung

PRSS55 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 940866
• UniProt: Q6UWB4
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: SKMFPKLTKNMLCAGYKNESYDACKGDSGGPLVCTPEPGEKWYQVGIISW

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PRSS55 Rabbit Polyclonal Antibody (orb587723). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings