PRSS55 Peptide - C-terminal region

Product Overview

• Article Name: PRSS55 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004166
• Supplier Catalog Number: orb2004166
• Alternative Catalog Number: BYT-ORB2004166-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: T-SP1, UNQ9391

Product Description

PRSS55 Peptide - C-terminal region

Product Properties

• NCBI: 940866
• UniProt: Q6UWB4
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: SKMFPKLTKNMLCAGYKNESYDACKGDSGGPLVCTPEPGEKWYQVGIISW

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PRSS55 Rabbit Polyclonal Antibody (orb587723). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings