PRSS45 Peptide - C-terminal region

Produktübersicht

• Artikelname: PRSS45 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004167
• Hersteller Artikelnummer: orb2004167
• Alternativnummer: BYT-ORB2004167-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: TESSP5

Produktbeschreibung

PRSS45 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 954652
• UniProt: Q7RTY3
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: WILAGVLSWEKACVKAQNPGVYTRITKYTKWIKKQMSNGAFSGPCASACL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PRSS45 Rabbit Polyclonal Antibody (orb327093). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings