PRSS45 Peptide - C-terminal region

Product Overview

• Article Name: PRSS45 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004167
• Supplier Catalog Number: orb2004167
• Alternative Catalog Number: BYT-ORB2004167-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: TESSP5

Product Description

PRSS45 Peptide - C-terminal region

Product Properties

• NCBI: 954652
• UniProt: Q7RTY3
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: WILAGVLSWEKACVKAQNPGVYTRITKYTKWIKKQMSNGAFSGPCASACL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PRSS45 Rabbit Polyclonal Antibody (orb327093). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings