OR8D1 Peptide - C-terminal region

Artikelnummer: BYT-ORB2004170
Artikelname: OR8D1 Peptide - C-terminal region
Artikelnummer: BYT-ORB2004170
Hersteller Artikelnummer: orb2004170
Alternativnummer: BYT-ORB2004170-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
Alternative Synonym: JCG9, OR8D3, OST004, PDJ9J14
OR8D1 Peptide - C-terminal region
NCBI: 001002917
UniProt: Q8WZ84
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: FFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKA
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with OR8D1 Rabbit Polyclonal Antibody (orb587616). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings