OR8D1 Peptide - C-terminal region

Product Overview

• Article Name: OR8D1 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004170
• Supplier Catalog Number: orb2004170
• Alternative Catalog Number: BYT-ORB2004170-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: JCG9, OR8D3, OST004, PDJ9J14

Product Description

OR8D1 Peptide - C-terminal region

Product Properties

• NCBI: 001002917
• UniProt: Q8WZ84
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: FFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKA

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OR8D1 Rabbit Polyclonal Antibody (orb587616). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings