OR5B17 Peptide - C-terminal region

Produktübersicht

• Artikelname: OR5B17 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004176
• Hersteller Artikelnummer: orb2004176
• Alternativnummer: BYT-ORB2004176-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: OR11-237, OR5B20P

Produktbeschreibung

OR5B17 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 001005489
• UniProt: Q8NGF7
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: FNVFFALLVTLISYLFILITILKRHTGKGYQKPLSTCGSHLIAIFLFYIT

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with OR5B17 Rabbit Polyclonal Antibody (orb587611). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings