OR5B17 Peptide - C-terminal region

Product Overview

• Article Name: OR5B17 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004176
• Supplier Catalog Number: orb2004176
• Alternative Catalog Number: BYT-ORB2004176-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: OR11-237, OR5B20P

Product Description

OR5B17 Peptide - C-terminal region

Product Properties

• NCBI: 001005489
• UniProt: Q8NGF7
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: FNVFFALLVTLISYLFILITILKRHTGKGYQKPLSTCGSHLIAIFLFYIT

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with OR5B17 Rabbit Polyclonal Antibody (orb587611). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings