PIEZO2 Peptide - N-terminal region

Artikelnummer: BYT-ORB2004186
Artikelname: PIEZO2 Peptide - N-terminal region
Artikelnummer: BYT-ORB2004186
Hersteller Artikelnummer: orb2004186
Alternativnummer: BYT-ORB2004186-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Applikation: WB
PIEZO2 Peptide - N-terminal region
UniProt: Q9H5I5
Puffer: Lyophilized powder
Formulierung: Lyophilized powder
Sequenz: Synthetic peptide located within the following region: VFGFWAFGKHSAAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRK
Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with PIEZO2 Rabbit Polyclonal Antibody (orb325498). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings