PIEZO2 Peptide - N-terminal region

Product Overview

• Article Name: PIEZO2 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004186
• Supplier Catalog Number: orb2004186
• Alternative Catalog Number: BYT-ORB2004186-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB

Product Description

PIEZO2 Peptide - N-terminal region

Product Properties

• UniProt: Q9H5I5
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: VFGFWAFGKHSAAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRK

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with PIEZO2 Rabbit Polyclonal Antibody (orb325498). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings