BMP10 Peptide - C-terminal region

Produktübersicht

• Artikelname: BMP10 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004192
• Hersteller Artikelnummer: orb2004192
• Alternativnummer: BYT-ORB2004192-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB

Produktbeschreibung

BMP10 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 055297
• UniProt: O95393
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: GYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLE

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with BMP10 Rabbit Polyclonal Antibody (orb579939). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings