BMP10 Peptide - C-terminal region

Catalog Number: BYT-ORB2004192
Article Name: BMP10 Peptide - C-terminal region
Biozol Catalog Number: BYT-ORB2004192
Supplier Catalog Number: orb2004192
Alternative Catalog Number: BYT-ORB2004192-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Application: WB
BMP10 Peptide - C-terminal region
NCBI: 055297
UniProt: O95393
Buffer: Lyophilized powder
Form: Lyophilized powder
Sequence: Synthetic peptide located within the following region: GYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLE
Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with BMP10 Rabbit Polyclonal Antibody (orb579939). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings