ZDHHC19 Peptide - N-terminal region

Produktübersicht

• Artikelname: ZDHHC19 Peptide - N-terminal region
• Artikelnummer: BYT-ORB2004214
• Hersteller Artikelnummer: orb2004214
• Alternativnummer: BYT-ORB2004214-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: DHHC19

Produktbeschreibung

ZDHHC19 Peptide - N-terminal region

Produkteigenschaften

• NCBI: 001034706
• UniProt: Q8WVZ1
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: FPCRWLAQNGEWAFPVITGSLFVLTFFSLVSLNFSDPGILHQGSAEQGPL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with ZDHHC19 Rabbit Polyclonal Antibody (orb573846). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings