ZDHHC19 Peptide - N-terminal region

Product Overview

• Article Name: ZDHHC19 Peptide - N-terminal region
• Biozol Catalog Number: BYT-ORB2004214
• Supplier Catalog Number: orb2004214
• Alternative Catalog Number: BYT-ORB2004214-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: DHHC19

Product Description

ZDHHC19 Peptide - N-terminal region

Product Properties

• NCBI: 001034706
• UniProt: Q8WVZ1
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: FPCRWLAQNGEWAFPVITGSLFVLTFFSLVSLNFSDPGILHQGSAEQGPL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with ZDHHC19 Rabbit Polyclonal Antibody (orb573846). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings