VN1R5 Peptide - middle region

Produktübersicht

• Artikelname: VN1R5 Peptide - middle region
• Artikelnummer: BYT-ORB2004219
• Hersteller Artikelnummer: orb2004219
• Alternativnummer: BYT-ORB2004219-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: V1RL5

Produktbeschreibung

VN1R5 Peptide - middle region

Produkteigenschaften

• NCBI: 776257
• UniProt: Q7Z5H4
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: AINSSTRLGSGGTQDDLRYKLIMNQTSQKKDSLSTSSFQSVKSISNSGKA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with VN1R5 Rabbit Polyclonal Antibody (orb587796). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings