VN1R5 Peptide - middle region

Product Overview

• Article Name: VN1R5 Peptide - middle region
• Biozol Catalog Number: BYT-ORB2004219
• Supplier Catalog Number: orb2004219
• Alternative Catalog Number: BYT-ORB2004219-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: V1RL5

Product Description

VN1R5 Peptide - middle region

Product Properties

• NCBI: 776257
• UniProt: Q7Z5H4
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: AINSSTRLGSGGTQDDLRYKLIMNQTSQKKDSLSTSSFQSVKSISNSGKA

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with VN1R5 Rabbit Polyclonal Antibody (orb587796). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings