VEPH1 Peptide - C-terminal region

Produktübersicht

• Artikelname: VEPH1 Peptide - C-terminal region
• Artikelnummer: BYT-ORB2004220
• Hersteller Artikelnummer: orb2004220
• Alternativnummer: BYT-ORB2004220-100
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Applikation: WB
• Alternative Synonym: MELT, VEPH

Produktbeschreibung

VEPH1 Peptide - C-terminal region

Produkteigenschaften

• NCBI: 078897
• UniProt: Q14D04
• Puffer: Lyophilized powder
• Formulierung: Lyophilized powder
• Sequenz: Synthetic peptide located within the following region: LPRAFEIFTDNKTYVFKAKDEKNAEEWLQCINVAVAQAKERESREVTTYL

Anwendungsbeschreibung

• Anwendungsbeschreibung: Application Notes: This is a synthetic peptide designed for use in combination with VEPH1 Rabbit Polyclonal Antibody (orb587793). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings