VEPH1 Peptide - C-terminal region

Product Overview

• Article Name: VEPH1 Peptide - C-terminal region
• Biozol Catalog Number: BYT-ORB2004220
• Supplier Catalog Number: orb2004220
• Alternative Catalog Number: BYT-ORB2004220-100
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Application: WB
• Alternative Names: MELT, VEPH

Product Description

VEPH1 Peptide - C-terminal region

Product Properties

• NCBI: 078897
• UniProt: Q14D04
• Buffer: Lyophilized powder
• Form: Lyophilized powder
• Sequence: Synthetic peptide located within the following region: LPRAFEIFTDNKTYVFKAKDEKNAEEWLQCINVAVAQAKERESREVTTYL

Application Notes

• Application Notes: Application Notes: This is a synthetic peptide designed for use in combination with VEPH1 Rabbit Polyclonal Antibody (orb587793). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings